| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) ![]() |
| Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
| Protein Ribosomal protein L31e [54577] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (19 PDB entries) |
| Domain d1ffku_: 1ffk U: [38458] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffku_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffku_ d.29.1.1 (U:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
dfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargr
antpskirvraarfeeegeaiveae
Timeline for d1ffku_: