SCOPe 2.07: Domain d6xx2a1: 6xx2 A:85-141

Lineage for d6xx2a1 (6xx2 A:85-141)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)

8. Domain d6xx2a1: 6xx2 A:85-141 [384571]
   Other proteins in same PDB: d6xx2a2
   automated match to d1e6ga_
   complexed with cu, qkh; mutant

Details for d6xx2a1

PDB Entry: 6xx2, 1.25 Å

PDB Description: crystal structure of the c-src sh3 domain h122r-q128k mutant in complex with cu(ii) at ph 7.5 co-crystallized with methyl beta- cyclodextrin

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d6xx2a1:

Sequence, based on SEQRES records:

>d6xx2a1 b.34.2.0 (A:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlarslttgktgyipsnyvapsd

Sequence, based on observed residues (ATOM records):

>d6xx2a1 b.34.2.0 (A:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivgdwwlarslttgktgyipsnyvapsd

Timeline for d6xx2a1:

• d6xx2a1 is new in SCOPe 2.07-stable
  
• d6xx2a1 appears in the current release, SCOPe 2.08