SCOP 1.57: Domain d1hnxs_: 1hnx S:

Lineage for d1hnxs_ (1hnx S:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)

8. Domain d1hnxs_: 1hnx S: [38455]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxt_, d1hnxv_

Details for d1hnxs_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxs_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1hnxs_:

• d1hnxs_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxs_ appears in SCOP 1.59
  
• d1hnxs_ appears in the current release, SCOPe 2.08