![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
![]() | Domain d1hnxs_: 1hnx S: [38455] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOPe Domain Sequences for d1hnxs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1hnxs_: