Lineage for d1hnzs_ (1hnz S:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79148Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
  4. 79149Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 79150Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 79151Protein Ribosomal protein S19 [54572] (1 species)
  7. 79152Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)
  8. 79156Domain d1hnzs_: 1hnz S: [38453]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzt_, d1hnzv_

Details for d1hnzs_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1hnzs_:

Click to download the PDB-style file with coordinates for d1hnzs_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzs_: