| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
| Domain d1hr0s_: 1hr0 S: [38452] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOPe Domain Sequences for d1hr0s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d1hr0s_: