Lineage for d1hr0s_ (1hr0 S:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410293Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 410294Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 410295Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 410296Protein Ribosomal protein S19 [54572] (1 species)
  7. 410297Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries)
  8. 410299Domain d1hr0s_: 1hr0 S: [38452]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0s_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1hr0s_:

Click to download the PDB-style file with coordinates for d1hr0s_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0s_: