| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.0: automated matches [384415] (1 protein) not a true family |
| Protein automated matches [384416] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [384417] (1 PDB entry) |
| Domain d6t0bs_: 6t0b s: [384519] Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bt_, d6t0bw_ automated match to d1ocre_ complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn |
PDB Entry: 6t0b (more details), 2.8 Å
SCOPe Domain Sequences for d6t0bs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t0bs_ a.118.11.0 (s:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
deetfeeftaryekefdeaydlfevqrvlnncfsydlvpapaviekalraarrvndlpta
irvfealkykvenedqykayldelkdvrqelgvplkeelfps
Timeline for d6t0bs_:
View in 3DDomains from other chains: (mouse over for more information) d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bt_, d6t0bw_ |