Lineage for d6wj8d_ (6wj8 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897331Species Klebsiella pneumoniae [TaxId:1379688] [384493] (1 PDB entry)
  8. 2897335Domain d6wj8d_: 6wj8 D: [384494]
    automated match to d1sffa_

Details for d6wj8d_

PDB Entry: 6wj8 (more details), 2.59 Å

PDB Description: crystal structure of gamma-aminobutyrate aminotransferase puue from klebsiella pneumoniae in complex with plp
PDB Compounds: (D:) 4-aminobutyrate aminotransferase PuuE

SCOPe Domain Sequences for d6wj8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wj8d_ c.67.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1379688]}
sselnqrrqqatprgvgvmcnyfvekaenatlwdiegnevidfaagiavlntghrhpkvv
aavadqlqafthtayqivpyesyvslaerindlapidgpaktaffttgaeavenavkiar
aytgrpglitfgggfhgrtfmtmaltgkvapykigfgpfpgsvyhgvypnaahgvttada
lkslerifkadiapdqvaaiilepiqgeggfnvapadfmqalrdlcdthgilliadevqt
gfartgklfamqhyevkpdlmtmakslaggfplsgvvgraevmdapapgglggtyagnpl
avaaahavldviaeeqlcqraeqlgshlqevlnqaratcpaivdvrgrgsmvavefndpq
tgepspeftrlvqqkaqengllllscgvygnvirflypltipdaqfskaldilarvlks

SCOPe Domain Coordinates for d6wj8d_:

Click to download the PDB-style file with coordinates for d6wj8d_.
(The format of our PDB-style files is described here.)

Timeline for d6wj8d_: