Lineage for d1hnxp_ (1hnx P:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327467Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 327468Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 327469Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 327470Protein Ribosomal protein S16 [54567] (1 species)
  7. 327471Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 327479Domain d1hnxp_: 1hnx P: [38449]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxp_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1hnxp_:

Click to download the PDB-style file with coordinates for d1hnxp_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxp_: