Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (1 species) |
Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries) |
Domain d1hnxp_: 1hnx P: [38449] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqearega
Timeline for d1hnxp_: