Lineage for d6wi2a1 (6wi2 A:56-455)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895951Protein automated matches [190399] (10 species)
    not a true protein
  7. 2895970Species Human (Homo sapiens) [TaxId:9606] [189951] (11 PDB entries)
  8. 2895980Domain d6wi2a1: 6wi2 A:56-455 [384478]
    Other proteins in same PDB: d6wi2a2, d6wi2b_, d6wi2c_, d6wi2d1, d6wi2d2
    automated match to d3lvma_
    complexed with 1pe, 8q1, edo, edt, ete, gol, mes, peg, pg4, pge, plp; mutant

Details for d6wi2a1

PDB Entry: 6wi2 (more details), 1.95 Å

PDB Description: structure of human mitochondrial complex nfs1-iscu2-isd11 with e.coli acp1 at 1.95 a resolution (niau)2. n-terminal mutation of iscu2 (l35) traps nfs1 cys loop in the active site of iscu2 without metal present.
PDB Compounds: (A:) Cysteine desulfurase, mitochondrial

SCOPe Domain Sequences for d6wi2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wi2a1 c.67.1.3 (A:56-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrplymdvqattpldprvldamlpylinyygnphsrthaygweseaamerarqqvaslig
adpreiiftsgatesnniaikgvarfyrsrkkhlittqtehkcvldscrsleaegfqvty
lpvqksgiidlkeleaaiqpdtslvsvmtvnneigvkqpiaeigricssrkvyfhtdaaq
avgkipldvndmkidlmsisghkiygpkgvgaiyirrrprvrvealqsgggqergmrsgt
vptplvvglgaacevaqqemeydhkrisklserliqnimkslpdvvmngdpkhhypgcin
lsfayvegesllmalkdvalssgsactsaslepsyvlraigtdedlahssirfgigrftt
eeevdytvekciqhvkrlremsplwemvqdgidlksikwt

SCOPe Domain Coordinates for d6wi2a1:

Click to download the PDB-style file with coordinates for d6wi2a1.
(The format of our PDB-style files is described here.)

Timeline for d6wi2a1: