Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189951] (11 PDB entries) |
Domain d6wi2a1: 6wi2 A:56-455 [384478] Other proteins in same PDB: d6wi2a2, d6wi2b_, d6wi2c_, d6wi2d1, d6wi2d2 automated match to d3lvma_ complexed with 1pe, 8q1, edo, edt, ete, gol, mes, peg, pg4, pge, plp; mutant |
PDB Entry: 6wi2 (more details), 1.95 Å
SCOPe Domain Sequences for d6wi2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wi2a1 c.67.1.3 (A:56-455) automated matches {Human (Homo sapiens) [TaxId: 9606]} lrplymdvqattpldprvldamlpylinyygnphsrthaygweseaamerarqqvaslig adpreiiftsgatesnniaikgvarfyrsrkkhlittqtehkcvldscrsleaegfqvty lpvqksgiidlkeleaaiqpdtslvsvmtvnneigvkqpiaeigricssrkvyfhtdaaq avgkipldvndmkidlmsisghkiygpkgvgaiyirrrprvrvealqsgggqergmrsgt vptplvvglgaacevaqqemeydhkrisklserliqnimkslpdvvmngdpkhhypgcin lsfayvegesllmalkdvalssgsactsaslepsyvlraigtdedlahssirfgigrftt eeevdytvekciqhvkrlremsplwemvqdgidlksikwt
Timeline for d6wi2a1:
View in 3D Domains from other chains: (mouse over for more information) d6wi2b_, d6wi2c_, d6wi2d1, d6wi2d2 |