SCOPe 2.08: Domain d6wjoa_: 6wjo A:

Lineage for d6wjoa_ (6wjo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.0: automated matches [194896] (1 protein)
   not a true family

6. Protein automated matches [194897] (4 species)
   not a true protein

7. Species Corynebacterium pseudotuberculosis [TaxId:681645] [384476] (2 PDB entries)

8. Domain d6wjoa_: 6wjo A: [384477]
   automated match to d5jvoa_
   complexed with na, so4, tyr

Details for d6wjoa_

PDB Entry: 6wjo, 1.69 Å

PDB Description: crystal structure of wild-type arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis bound to tyrosine

PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d6wjoa_:

Sequence; same for both SEQRES and ATOM records:

>d6wjoa_ d.74.2.0 (A:) automated matches {Corynebacterium pseudotuberculosis [TaxId: 681645]}
gtreklrkmlddllvsvdhsgniavlrtppggapflasfidrvgmeevvgtiagddtvfv
lardpmtgqelgeflsqrr

Timeline for d6wjoa_:

• d6wjoa_ first appeared in SCOPe 2.07