![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
![]() | Domain d1hr0p_: 1hr0 P: [38446] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOPe Domain Sequences for d1hr0p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d1hr0p_: