SCOPe 2.07: Domain d6t0bc2: 6t0b C:262-385

Lineage for d6t0bc2 (6t0b C:262-385)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257469] (3 PDB entries)

8. Domain d6t0bc2: 6t0b C:262-385 [384441]
   Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
   automated match to d1kb9c1
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bc2

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d6t0bc2:

Sequence; same for both SEQRES and ATOM records:

>d6t0bc2 f.32.1.0 (C:262-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d6t0bc2:

• d6t0bc2 is new in SCOPe 2.07-stable
  
• d6t0bc2 appears in the current release, SCOPe 2.08