Lineage for d1d2ka2 (1d2k A:293-354)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. Protein Chitinase 1 [54562] (2 species)
  7. Species Fungus (Coccidioides immitis) [TaxId:5501] [54563] (4 PDB entries)
  8. Domain d1d2ka2: 1d2k A:293-354 [38442]
    Other proteins in same PDB: d1d2ka1

Details for d1d2ka2

PDB Entry: 1d2k (more details), 2.2 Å

PDB Description: c. immitis chitinase 1 at 2.2 angstroms resolution
PDB Compounds: (A:) chitinase 1

SCOPe Domain Sequences for d1d2ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ka2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtelediaasysydknkryli
sy

SCOPe Domain Coordinates for d1d2ka2 are not available.

Timeline for d1d2ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ka1