SCOP 1.63: Domain d1e15b3: 1e15 B:292-379

Lineage for d1e15b3 (1e15 B:292-379)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (9 PDB entries)

8. Domain d1e15b3: 1e15 B:292-379 [38441]
   Other proteins in same PDB: d1e15a1, d1e15a2, d1e15b1, d1e15b2

Details for d1e15b3

PDB Entry: 1e15, 1.9 Å

PDB Description: chitinase b from serratia marcescens

SCOP Domain Sequences for d1e15b3:

Sequence; same for both SEQRES and ATOM records:

>d1e15b3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1e15b3:

• d1e15b3 first appeared (with stable ids) in SCOP 1.55
  
• d1e15b3 appears in SCOP 1.61
  
• d1e15b3 appears in SCOP 1.65
  
• d1e15b3 appears in the current release, SCOPe 2.08