Lineage for d1ctna3 (1ctn A:444-516)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1900344Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1900345Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1900388Protein Chitinase A [54558] (1 species)
  7. 1900389Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
    Uniprot P07254 24-563
  8. 1900399Domain d1ctna3: 1ctn A:444-516 [38439]
    Other proteins in same PDB: d1ctna1, d1ctna2

Details for d1ctna3

PDB Entry: 1ctn (more details), 2.3 Å

PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ctna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctna3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOPe Domain Coordinates for d1ctna3:

Click to download the PDB-style file with coordinates for d1ctna3.
(The format of our PDB-style files is described here.)

Timeline for d1ctna3: