Lineage for d1ctn_3 (1ctn 444-516)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502029Protein Chitinase A [54558] (1 species)
  7. 502030Species Serratia marcescens [TaxId:615] [54559] (8 PDB entries)
  8. 502038Domain d1ctn_3: 1ctn 444-516 [38439]
    Other proteins in same PDB: d1ctn_1, d1ctn_2

Details for d1ctn_3

PDB Entry: 1ctn (more details), 2.3 Å

PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution

SCOP Domain Sequences for d1ctn_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctn_3 d.26.3.1 (444-516) Chitinase A {Serratia marcescens}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOP Domain Coordinates for d1ctn_3:

Click to download the PDB-style file with coordinates for d1ctn_3.
(The format of our PDB-style files is described here.)

Timeline for d1ctn_3: