SCOPe 2.08: Domain d5rb4a1: 5rb4 A:1380-1717

Lineage for d5rb4a1 (5rb4 A:1380-1717)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
   Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (100 PDB entries)

8. Domain d5rb4a1: 5rb4 A:1380-1717 [384389]
   Other proteins in same PDB: d5rb4a2, d5rb4b2
   automated match to d4c8da_
   complexed with a6z, cl, mn

Details for d5rb4a1

PDB Entry: 5rb4, 1.55 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd1b in complex with fm001677a

PDB Compounds: (A:) lysine-specific demethylase 3b

SCOPe Domain Sequences for d5rb4a1:

Sequence; same for both SEQRES and ATOM records:

>d5rb4a1 b.82.2.14 (A:1380-1717) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg
dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp
trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl
hldvsdavnvmvyvgipigegahdeevlktidegdadevtkerihdhkekpgalwhiyaa
kdaekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgd
avfipagaphqvhnlyscikvaedfvspehvkhcfrlt

Timeline for d5rb4a1:

• d5rb4a1 first appeared in SCOPe 2.07