Lineage for d5r86a_ (5r86 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2385158Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2385186Protein Interleukin-1beta [50363] (2 species)
  7. 2385187Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries)
    Uniprot P01584 117-269
  8. 3084324Domain d5r86a_: 5r86 A: [384386]
    automated match to d9ilba_
    complexed with gt4, so4

Details for d5r86a_

PDB Entry: 5r86 (more details), 1.5 Å

PDB Description: pandda analysis group deposition interleukin-1 beta -- fragment z943693514 in complex with interleukin-1 beta
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d5r86a_:

Sequence, based on SEQRES records: (download)

>d5r86a_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvs

Sequence, based on observed residues (ATOM records): (download)

>d5r86a_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflgggqditdftmqfvs

SCOPe Domain Coordinates for d5r86a_:

Click to download the PDB-style file with coordinates for d5r86a_.
(The format of our PDB-style files is described here.)

Timeline for d5r86a_:

  • d5r86a_ is new in SCOPe 2.07-stable