SCOPe 2.02: Domain d1ehna3: 1ehn A:444-516

Lineage for d1ehna3 (1ehn A:444-516)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase A [54558] (1 species)

7. Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
   Uniprot P07254 24-563

8. Domain d1ehna3: 1ehn A:444-516 [38438]
   Other proteins in same PDB: d1ehna1, d1ehna2
   mutant

Details for d1ehna3

PDB Entry: 1ehn, 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.

PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ehna3:

Sequence; same for both SEQRES and ATOM records:

>d1ehna3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

Timeline for d1ehna3:

• d1ehna3 first appeared (with stable ids) in SCOP 1.55
  
• d1ehna3 appears in SCOPe 2.01
  
• d1ehna3 appears in SCOPe 2.03
  
• d1ehna3 appears in the current release, SCOPe 2.08