![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase A [54558] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54559] (9 PDB entries) |
![]() | Domain d1ehna3: 1ehn A:444-516 [38438] Other proteins in same PDB: d1ehna1, d1ehna2 complexed with nag; mutant |
PDB Entry: 1ehn (more details), 1.9 Å
SCOP Domain Sequences for d1ehna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehna3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens} ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy vfkpstgdlitfd
Timeline for d1ehna3: