Lineage for d1edqa3 (1edq A:444-516)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327256Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 327386Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 327387Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 327401Protein Chitinase A [54558] (1 species)
  7. 327402Species Serratia marcescens [TaxId:615] [54559] (8 PDB entries)
  8. 327403Domain d1edqa3: 1edq A:444-516 [38436]
    Other proteins in same PDB: d1edqa1, d1edqa2

Details for d1edqa3

PDB Entry: 1edq (more details), 1.55 Å

PDB Description: crystal structure of chitinase a from s. marcescens at 1.55 angstroms

SCOP Domain Sequences for d1edqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOP Domain Coordinates for d1edqa3:

Click to download the PDB-style file with coordinates for d1edqa3.
(The format of our PDB-style files is described here.)

Timeline for d1edqa3: