SCOPe 2.08: Domain d6s0da2: 6s0d A:86-194

Lineage for d6s0da2 (6s0d A:86-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries)

8. Domain d6s0da2: 6s0d A:86-194 [384345]
   Other proteins in same PDB: d6s0da1, d6s0dc1
   automated match to d3dc5a2
   complexed with mn, so4; mutant

Details for d6s0da2

PDB Entry: 6s0d, 1.52 Å

PDB Description: h30 mnsod-3 mutant ii

PDB Compounds: (A:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6s0da2:

Sequence; same for both SEQRES and ATOM records:

>d6s0da2 d.44.1.0 (A:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

Timeline for d6s0da2:

• d6s0da2 first appeared in SCOPe 2.07