Lineage for d1grja2 (1grj A:80-158)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720582Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
  6. 720583Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
    N-terminal domain is a long alpha-hairpin
  7. 720584Species Escherichia coli [TaxId:562] [54551] (1 PDB entry)
  8. 720585Domain d1grja2: 1grj A:80-158 [38433]
    Other proteins in same PDB: d1grja1

Details for d1grja2

PDB Entry: 1grj (more details), 2.2 Å

PDB Description: grea transcript cleavage factor from escherichia coli
PDB Compounds: (A:) grea protein

SCOP Domain Sequences for d1grja2:

Sequence, based on SEQRES records: (download)

>d1grja2 d.26.1.2 (A:80-158) GreA transcript cleavage factor, C-terminal domain {Escherichia coli [TaxId: 562]}
mpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlisvnspiargligkeeddvv
viktpggevefevikveyl

Sequence, based on observed residues (ATOM records): (download)

>d1grja2 d.26.1.2 (A:80-158) GreA transcript cleavage factor, C-terminal domain {Escherichia coli [TaxId: 562]}
mpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlisvnspiargligkeeddvv
vivefevikveyl

SCOP Domain Coordinates for d1grja2:

Click to download the PDB-style file with coordinates for d1grja2.
(The format of our PDB-style files is described here.)

Timeline for d1grja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1grja1