Lineage for d1grj_2 (1grj 80-158)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79020Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 79021Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 79094Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
  6. 79095Protein GreA transcript cleavage factor, C-terminal domain [54550] (1 species)
  7. 79096Species Escherichia coli [TaxId:562] [54551] (1 PDB entry)
  8. 79097Domain d1grj_2: 1grj 80-158 [38433]
    Other proteins in same PDB: d1grj_1

Details for d1grj_2

PDB Entry: 1grj (more details), 2.2 Å

PDB Description: grea transcript cleavage factor from escherichia coli

SCOP Domain Sequences for d1grj_2:

Sequence, based on SEQRES records: (download)

>d1grj_2 d.26.1.2 (80-158) GreA transcript cleavage factor, C-terminal domain {Escherichia coli}
mpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlisvnspiargligkeeddvv
viktpggevefevikveyl

Sequence, based on observed residues (ATOM records): (download)

>d1grj_2 d.26.1.2 (80-158) GreA transcript cleavage factor, C-terminal domain {Escherichia coli}
mpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlisvnspiargligkeeddvv
vivefevikveyl

SCOP Domain Coordinates for d1grj_2:

Click to download the PDB-style file with coordinates for d1grj_2.
(The format of our PDB-style files is described here.)

Timeline for d1grj_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1grj_1