SCOP 1.59: Domain d1f8ab2: 1f8a B:55-167

Lineage for d1f8ab2 (1f8a B:55-167)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)

4. Superfamily d.26.1: FKBP-like [54534] (2 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (2 PDB entries)

8. Domain d1f8ab2: 1f8a B:55-167 [38432]
   Other proteins in same PDB: d1f8ab1

Details for d1f8ab2

PDB Entry: 1f8a, 1.84 Å

PDB Description: structural basis for the phosphoserine-proline recognition by group iv ww domains

SCOP Domain Sequences for d1f8ab2:

Sequence; same for both SEQRES and ATOM records:

>d1f8ab2 d.26.1.1 (B:55-167) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens)}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d1f8ab2:

• d1f8ab2 first appeared (with stable ids) in SCOP 1.55
  
• d1f8ab2 appears in SCOP 1.57
  
• d1f8ab2 appears in SCOP 1.61
  
• d1f8ab2 appears in the current release, SCOPe 2.08