![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) |
![]() | Superfamily d.26.1: FKBP-like [54534] (2 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins) |
![]() | Protein Mitotic rotamase PIN1, domain 2 [54547] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54548] (2 PDB entries) |
![]() | Domain d1f8ab2: 1f8a B:55-167 [38432] Other proteins in same PDB: d1f8ab1 |
PDB Entry: 1f8a (more details), 1.84 Å
SCOP Domain Sequences for d1f8ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8ab2 d.26.1.1 (B:55-167) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens)} eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d1f8ab2: