![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) |
![]() | Superfamily d.26.1: FKBP-like [54534] (2 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins) |
![]() | Protein Mitotic rotamase PIN1, domain 2 [54547] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54548] (2 PDB entries) |
![]() | Domain d1pina2: 1pin A:45-163 [38431] Other proteins in same PDB: d1pina1 |
PDB Entry: 1pin (more details), 1.35 Å
SCOP Domain Sequences for d1pina2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens)} gkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfe slasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d1pina2: