SCOPe 2.08: Domain d1pina2: 1pin A:45-163

Lineage for d1pina2 (1pin A:45-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries)

8. Domain d1pina2: 1pin A:45-163 [38431]
   Other proteins in same PDB: d1pina1
   complexed with 1pg, ala, pro, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1pina2

PDB Entry: 1pin, 1.35 Å

PDB Description: pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d1pina2:

Sequence; same for both SEQRES and ATOM records:

>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
gkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfe
slasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d1pina2:

• d1pina2 first appeared (with stable ids) in SCOP 1.55
  
• d1pina2 appears in SCOPe 2.07