SCOP 1.55: Domain d1rot__: 1rot -

Lineage for d1rot__ (1rot -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)

4. Superfamily d.26.1: FKBP-like [54534] (2 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins)

6. Protein FKBP59-I, N-terminal domain [54545] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54546] (2 PDB entries)

8. Domain d1rot__: 1rot - [38429]

Details for d1rot__

PDB Entry: 1rot

PDB Description: structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure

SCOP Domain Sequences for d1rot__:

Sequence; same for both SEQRES and ATOM records:

>d1rot__ d.26.1.1 (-) FKBP59-I, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg

Timeline for d1rot__:

• d1rot__ appears in SCOP 1.57
  
• d1rot__ appears in the current release, SCOPe 2.08, called d1rota_