Lineage for d1pbk__ (1pbk -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31479Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 31480Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 31481Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins)
  6. 31535Protein FKBP25 [54543] (1 species)
  7. 31536Species Human (Homo sapiens) [TaxId:9606] [54544] (1 PDB entry)
  8. 31537Domain d1pbk__: 1pbk - [38428]

Details for d1pbk__

PDB Entry: 1pbk (more details), 2.5 Å

PDB Description: homologous domain of human fkbp25

SCOP Domain Sequences for d1pbk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbk__ d.26.1.1 (-) FKBP25 {Human (Homo sapiens)}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

SCOP Domain Coordinates for d1pbk__:

Click to download the PDB-style file with coordinates for d1pbk__.
(The format of our PDB-style files is described here.)

Timeline for d1pbk__: