Lineage for d1pbka_ (1pbk A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2509611Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2509612Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 protein domains)
  6. 2509706Protein FKBP25 [54543] (1 species)
  7. 2509707Species Human (Homo sapiens) [TaxId:9606] [54544] (3 PDB entries)
  8. 2509710Domain d1pbka_: 1pbk A: [38428]
    complexed with rap

Details for d1pbka_

PDB Entry: 1pbk (more details), 2.5 Å

PDB Description: homologous domain of human fkbp25
PDB Compounds: (A:) fkbp25

SCOPe Domain Sequences for d1pbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

SCOPe Domain Coordinates for d1pbka_:

Click to download the PDB-style file with coordinates for d1pbka_.
(The format of our PDB-style files is described here.)

Timeline for d1pbka_: