Lineage for d5rb1a1 (5rb1 A:1380-1717)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404954Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2405080Protein automated matches [254635] (1 species)
    not a true protein
  7. 2405081Species Human (Homo sapiens) [TaxId:9606] [255633] (301 PDB entries)
  8. 3084214Domain d5rb1a1: 5rb1 A:1380-1717 [384276]
    Other proteins in same PDB: d5rb1a2, d5rb1b2
    automated match to d4c8da_
    complexed with cl, mn, s4v

Details for d5rb1a1

PDB Entry: 5rb1 (more details), 1.76 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd1b in complex with fm001700a
PDB Compounds: (A:) lysine-specific demethylase 3b

SCOPe Domain Sequences for d5rb1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rb1a1 b.82.2.14 (A:1380-1717) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg
dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp
trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl
hldvsdavnvmvyvgipigegahdeevlktidegdadevtkerihdhkekpgalwhiyaa
kdaekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgd
avfipagaphqvhnlyscikvaedfvspehvkhcfrlt

SCOPe Domain Coordinates for d5rb1a1:

Click to download the PDB-style file with coordinates for d5rb1a1.
(The format of our PDB-style files is described here.)

Timeline for d5rb1a1:

  • d5rb1a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5rb1a2