SCOPe 2.07: Domain d6thea2: 6the A:154-306

Lineage for d6thea2 (6the A:154-306)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:566679] [384270] (9 PDB entries)

8. Domain d6thea2: 6the A:154-306 [384272]
   automated match to d1kbva2
   complexed with 9je, cl, cu, er3, tb, yb, yt3

Details for d6thea2

PDB Entry: 6the, 2.87 Å

PDB Description: crystal structure of core domain of four-domain heme-cupredoxin-cu nitrite reductase from bradyrhizobium sp. ors 375

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6thea2:

Sequence; same for both SEQRES and ATOM records:

>d6thea2 b.6.1.0 (A:154-306) automated matches {Bradyrhizobium sp. [TaxId: 566679]}
dhefyvmqgeiysdipygqhgsaefsvekllaerpeyfvfngsvgalsklhplkakvgdt
vriffgvggpnhassfhvigeifdkvdlfgglttpplagiqtvtvppggaaiaefkvevp
gtytlvdhalaraergllgilhvqgpenpdiyn

Timeline for d6thea2:

• d6thea2 is new in SCOPe 2.07-stable
  
• d6thea2 appears in the current release, SCOPe 2.08