SCOPe 2.08: Domain d6t0bh_: 6t0b H:

Lineage for d6t0bh_ (6t0b H:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries)

8. Domain d6t0bh_: 6t0b H: [384255]
   Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
   automated match to d3cx5h_
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bh_

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (H:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d6t0bh_:

Sequence; same for both SEQRES and ATOM records:

>d6t0bh_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

Timeline for d6t0bh_:

• d6t0bh_ first appeared in SCOPe 2.07