Lineage for d6t0bg_ (6t0b G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027685Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027686Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 3027687Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 3027717Protein automated matches [190325] (4 species)
    not a true protein
  7. 3027720Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (5 PDB entries)
  8. 3027727Domain d6t0bg_: 6t0b G: [384254]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0bs_, d6t0bt_, d6t0bw_
    automated match to d3cx5g_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bg_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 7

SCOPe Domain Sequences for d6t0bg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bg_ f.27.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
nievsk

SCOPe Domain Coordinates for d6t0bg_:

Click to download the PDB-style file with coordinates for d6t0bg_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bg_: