Lineage for d1c9ha_ (1c9h A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255713Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 255714Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins)
  6. 255715Protein Calcineurin (FKBP12.6) [54539] (3 species)
  7. 255720Species Human (Homo sapiens) [TaxId:9606] [54540] (1 PDB entry)
  8. 255721Domain d1c9ha_: 1c9h A: [38425]
    complexed with rap

Details for d1c9ha_

PDB Entry: 1c9h (more details), 2 Å

PDB Description: crystal structure of fkbp12.6 in complex with rapamycin

SCOP Domain Sequences for d1c9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ha_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Human (Homo sapiens)}
gveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle

SCOP Domain Coordinates for d1c9ha_:

Click to download the PDB-style file with coordinates for d1c9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ha_: