Lineage for d1fkka_ (1fkk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941354Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 2941355Species Cow (Bos taurus) [TaxId:9913] [54538] (2 PDB entries)
  8. 2941357Domain d1fkka_: 1fkk A: [38424]
    complexed with so4

Details for d1fkka_

PDB Entry: 1fkk (more details), 2.2 Å

PDB Description: atomic structure of fkbp12, an immunophilin binding protein
PDB Compounds: (A:) fk506 binding protein

SCOPe Domain Sequences for d1fkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkka_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Cow (Bos taurus) [TaxId: 9913]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle

SCOPe Domain Coordinates for d1fkka_:

Click to download the PDB-style file with coordinates for d1fkka_.
(The format of our PDB-style files is described here.)

Timeline for d1fkka_: