Lineage for d5rb1b1 (5rb1 B:1380-1725)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
    Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)
  6. Protein automated matches [254635] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255633] (100 PDB entries)
  8. Domain d5rb1b1: 5rb1 B:1380-1725 [384228]
    Other proteins in same PDB: d5rb1a2, d5rb1b2
    automated match to d4c8da_
    complexed with cl, mn, s4v

Details for d5rb1b1

PDB Entry: 5rb1 (more details), 1.7600000000000002 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd1b in complex with fm001700a
PDB Compounds: (B:) lysine-specific demethylase 3b

SCOPe Domain Sequences for d5rb1b1:

Sequence, based on SEQRES records: (download)

>d5rb1b1 b.82.2.14 (B:1380-1725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg
dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp
trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl
hldvsdavnvmvyvgipigegahdeevlktidegdadevtkerihdhkekpgalwhiyaa
kdaekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgd
avfipagaphqvhnlyscikvaedfvspehvkhcfrltqefrhlsn

Sequence, based on observed residues (ATOM records): (download)

>d5rb1b1 b.82.2.14 (B:1380-1725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg
dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp
trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl
hldvsdavnvmvyvgipiahdeevlktidegdadevtkerihdhkekpgalwhiyaakda
ekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgdavf
ipagaphqvhnlyscikvaedfvspehvkhcfrltqefrhlsn

SCOPe Domain Coordinates for d5rb1b1 are not available.

Timeline for d5rb1b1:

Domains from same chain:
(mouse over for more information)
d5rb1b2
Domains from other chains:
(mouse over for more information)
d5rb1a1, d5rb1a2