Lineage for d6t0be2 (6t0b E:87-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782357Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species)
  7. 2782369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [384197] (1 PDB entry)
  8. 2782370Domain d6t0be2: 6t0b E:87-215 [384225]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
    automated match to d1kb9e1
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0be2

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6t0be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0be2 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOPe Domain Coordinates for d6t0be2:

Click to download the PDB-style file with coordinates for d6t0be2.
(The format of our PDB-style files is described here.)

Timeline for d6t0be2: