Lineage for d6t0bt_ (6t0b T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026053Protein automated matches [190326] (4 species)
    not a true protein
  7. 3026056Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (5 PDB entries)
  8. 3026064Domain d6t0bt_: 6t0b T: [384211]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bw_
    automated match to d3cx5i_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bt_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (T:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d6t0bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bt_ f.23.14.1 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d6t0bt_:

Click to download the PDB-style file with coordinates for d6t0bt_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bt_: