SCOPe 2.07: Domain d6t0bo1: 6t0b O:62-260

Lineage for d6t0bo1 (6t0b O:62-260)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (4 species)

7. Species Saccharomyces cerevisiae [TaxId:559292] [384199] (1 PDB entry)

8. Domain d6t0bo1: 6t0b O:62-260 [384200]
   Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
   automated match to d1kyod1
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bo1

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (O:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d6t0bo1:

Sequence; same for both SEQRES and ATOM records:

>d6t0bo1 a.3.1.3 (O:62-260) Cytochrome bc1 domain {Saccharomyces cerevisiae [TaxId: 559292]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

Timeline for d6t0bo1:

• d6t0bo1 is new in SCOPe 2.07-stable
  
• d6t0bo1 appears in the current release, SCOPe 2.08