![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [384197] (1 PDB entry) |
![]() | Domain d6t0bp2: 6t0b P:87-215 [384198] Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_ automated match to d1kb9e1 complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn |
PDB Entry: 6t0b (more details), 2.8 Å
SCOPe Domain Sequences for d6t0bp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t0bp2 b.33.1.1 (P:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye fdgdkvivg
Timeline for d6t0bp2:
![]() Domains from other chains: (mouse over for more information) d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_ |