Lineage for d5qbta_ (5qbt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2801552Protein Endothiapepsin [50647] (1 species)
  7. 2801553Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries)
  8. 2801802Domain d5qbta_: 5qbt A: [384190]
    automated match to d1oewa_
    complexed with act, ddv, dms, edo, gol, peg

Details for d5qbta_

PDB Entry: 5qbt (more details), 1.3 Å

PDB Description: crystal structure of endothiapepsin-nat17-346985 complex
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5qbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qbta_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5qbta_:

Click to download the PDB-style file with coordinates for d5qbta_.
(The format of our PDB-style files is described here.)

Timeline for d5qbta_: