Lineage for d5qbia_ (5qbi A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393116Protein Endothiapepsin [50647] (1 species)
  7. 2393117Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries)
  8. 3084104Domain d5qbia_: 5qbi A: [384166]
    automated match to d1oewa_
    complexed with act, d8p, gol

Details for d5qbia_

PDB Entry: 5qbi (more details), 1.62 Å

PDB Description: crystal structure of endothiapepsin-frg274 complex
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5qbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qbia_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5qbia_:

Click to download the PDB-style file with coordinates for d5qbia_.
(The format of our PDB-style files is described here.)

Timeline for d5qbia_:

  • d5qbia_ is new in SCOPe 2.07-stable