Lineage for d6lt6a1 (6lt6 A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938641Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [384001] (4 PDB entries)
  8. 2938648Domain d6lt6a1: 6lt6 A:1-181 [384144]
    Other proteins in same PDB: d6lt6a2, d6lt6b_
    automated match to d1efxa2
    complexed with edo, ekg, na

Details for d6lt6a1

PDB Entry: 6lt6 (more details), 2.15 Å

PDB Description: crystal structure of rhesus macaque mhc class i molecule mamu-b*05104 complexed with lysophosphatidylcholine
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6lt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lt6a1 d.19.1.1 (A:1-181) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
gshslryfgtavsrpgrgeprfiyvgyvddtqfvrfdsdaasprteprapwveqegpeyw
eeetrrakaraqtdradlrtlrgyynqseagshtlqwmagcdlgpngrllrgyhqsaydg
kdyialnedlrswiaadmaaqntqrkweatryaerfraylegpclewlrrylengketlq
h

SCOPe Domain Coordinates for d6lt6a1:

Click to download the PDB-style file with coordinates for d6lt6a1.
(The format of our PDB-style files is described here.)

Timeline for d6lt6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lt6a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6lt6b_