Lineage for d1b6cc_ (1b6c C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408360Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1408364Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 1408412Domain d1b6cc_: 1b6c C: [38414]
    Other proteins in same PDB: d1b6cb_, d1b6cd_, d1b6cf_, d1b6ch_
    complexed with so4

Details for d1b6cc_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
PDB Compounds: (C:) fk506-binding protein

SCOPe Domain Sequences for d1b6cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6cc_ d.26.1.1 (C:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1b6cc_:

Click to download the PDB-style file with coordinates for d1b6cc_.
(The format of our PDB-style files is described here.)

Timeline for d1b6cc_: