Lineage for d1b6cc_ (1b6c C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410016Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 410017Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 410018Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (15 proteins)
  6. 410029Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 410033Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)
  8. 410073Domain d1b6cc_: 1b6c C: [38414]
    Other proteins in same PDB: d1b6cb_, d1b6cd_, d1b6cf_, d1b6ch_

Details for d1b6cc_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12

SCOP Domain Sequences for d1b6cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6cc_ d.26.1.1 (C:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1b6cc_:

Click to download the PDB-style file with coordinates for d1b6cc_.
(The format of our PDB-style files is described here.)

Timeline for d1b6cc_: