SCOPe 2.08: Domain d6omga1: 6omg A:6-185

Lineage for d6omga1 (6omg A:6-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6omga1: 6omg A:6-185 [384137]
   Other proteins in same PDB: d6omga2, d6omgb_, d6omgc1, d6omgc2, d6omgd1, d6omgd2
   automated match to d1zt4c2
   complexed with gol, mvv, na

Details for d6omga1

PDB Entry: 6omg, 2.1 Å

PDB Description: structure of mouse cd1d- glc-dag (sn-1 c18:0, sn-2 c18:1c9)-inkt tcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6omga1:

Sequence; same for both SEQRES and ATOM records:

>d6omga1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6omga1:

• d6omga1 first appeared in SCOPe 2.07